SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR253C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR253C
Domain Number 1 Region: 93-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000221
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR253C
Sequence length 191
Comment MET32 ORF Verified Zinc-finger DNA-binding protein, involved in transcriptional regulation of the methionine biosynthetic genes, similar to Met31p
Sequence
MEDQDAAFIKQATEAIVDVSLNIDNIDPIIKELLERVRNRQNRLQNKKPALIPAENGVDI
NSQGGNIKVKKENALPKPPKSSKSKPQDRRNSTGEKRFKCAKCSLEFSRSSDLRRHEKTH
FAILPNICPQCGKGFARKDALKRHYDTLTCRRNRTKLLTAGGEGINELLKKVKQSNIVHR
QDNNHNGSSNG
Download sequence
Identical sequences A0A0L8VTL7 A0A250W8S5 B3LG37 B5VGD7 C7GTI8 C8Z5G5 E7KLU7 G2WAZ6 H0GE91 N1P531 Q12041
YDR253C YDR253C NP_010539.1.97178 YDR253C YDR253C YDR253C YDR253C YDR253C SCRT_00273 YDR253C 4932.YDR253C YDR253C YDR253C YDR253C YDR253C YDR253C YDR253C YDR253C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]