SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR263C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR263C
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily PIN domain-like 2.24e-61
Family 5' to 3' exonuclease catalytic domain 0.00078
Further Details:      
 
Domain Number 2 Region: 212-305
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 2.54e-16
Family 5' to 3' exonuclease, C-terminal subdomain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR263C
Sequence length 430
Comment DIN7 ORF Verified Mitochondrial nuclease functioning in DNA repair and replication, modulates the stability of the mitochondrial genome, induced by exposure to mutagens, also induced during meiosis at a time nearly coincident with commitment to recombination
Sequence
MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMNKPTNKYLQFFI
KRLQLLKRLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYFQ
KSVDITPEMAKCIIDYCKLHSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDLLVFGCK
TLITKLNDQGKALEISKDDFSALPENFPLGELSEQQFLNLVCLAGCDYTSGIWKVGVVTA
MKIVKRYSEMKDILIQIERTEKLCFSKAFKQQVEFANYAFQYQRVFCPLSNQITTLNNIP
KAVTNSHAEIIKIMKCIGSVVERGSGVRKDVINTKNIDHKVHEMIAKGELHPVDMASKLI
NRERKLKARKLFKVGLLGGESNSFNKKVEQPLVDTQDVLSERENSLDNKNASSIYMTSPA
AISGTVPSIF
Download sequence
Identical sequences C7GS84
YDR263C YDR263C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]