SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER028C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER028C
Domain Number 1 Region: 15-69
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000418
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YER028C
Sequence length 394
Comment MIG3 ORF Verified Probable transcriptional repressor involved in response to toxic agents such as hydroxyurea that inhibit ribonucleotide reductase; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genes
Sequence
MNYLRDRFPPDNDQRPFRCEICSRGFHRLEHKKRHVRTHTGEKPHQCTVQGCPKSFSRSD
ELKRHLRTHTKGVQRRRIKSKGSRKTVVNTATAAPTTFNENTGVSLTGIGQPKVPPILIS
VAQNCDDVNIRNTGNNNGIVETQAPAILVPVISIQNDPHPIPSNLSTTSITSIASVYPST
SPFQYLKSGFPEDPASTLYVHSSGSSLALGELSSNSSIFSKSRRNLAAMSGPDSLGSSKN
QSSASLLSQTSHPSKSFSRPPTDLSPLRRIMPSVNTGDMEISRTVSVSSSSSSPTSVTYD
DTAAKDMGMGIFFDRQPVTQKACRSNHKYKVNAVSRGRQHERAQFHISGDDEDSNVHRQE
SGASNTNPKVSLPPIKSILRQIDNFNSAPSYFSK
Download sequence
Identical sequences C7GSH5
YER028C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]