SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER130C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER130C
Domain Number 1 Region: 387-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000911
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YER130C
Sequence length 443
Comment ORF Uncharacterized Protein of unknown function; transcription is regulated by Haa1p, Sok2p and Zap1p transcriptional activators; the C. Albicans homolog (MNL1) plays a role in adaptation to stress
Sequence
MSLYPLQRFESNDTVFSYTLNSKTELFNESRNNDKQHFTLQLIPNANANAKEIDNNNVEI
INDLTGNTIVDNCVTTATSSNQLERRLSISDYRTENGNYYEYEFFGRRELNEPLFNNDIV
ENDDDIDLNNESDVLMVSDDELEVNERFSFLKQQPLDGLNRISSTNNLKNLEIHEFIIDP
TENIDDELEDSFTTVPQSKKKVRDYFKLNIFGSSSSSNNNSNSLGCEPIQTENSSSQKMF
KNRFFRSRKSTLIKSLPLEQENEVLINSGFDVSSNEESDESDHAIINPLKLVGNNKDIST
QSIAKTTNPFKSGSDFKMIEPVSKFSNDSRKDLLAAISEPSSSPSPSAPSPSVQSSSSSH
GLVVRKKTGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTC
HICNKNFSRSDNLNQHVKTHASL
Download sequence
Identical sequences A0A0L8VRI8 C7GKX7 C8Z7E7 E7QE20 P39959
YER130C YER130C YER130C NP_011056.1.97178 YER130C YER130C YER130C YER130C YER130C 4932.YER130C YER130C YER130C YER130C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]