SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER169W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER169W
Domain Number 1 Region: 141-350
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-28
Family PhyH-like 0.058
Further Details:      
 
Domain Number 2 Region: 707-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000111
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YER169W
Sequence length 796
Comment RPH1 ORF Verified JmjC domain-containing histone demethylase which can specifically demethylate H3K36 tri- and dimethyl modification states; transcriptional repressor of PHR1; Rph1p phosphorylation during DNA damage is under control of the MEC1-RAD53 pathway
Sequence
MTKLIAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPY
SAETLQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNS
RKGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTIDLSDLQNTERLKFLEEYYWKTLNFTT
PMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQD
LYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQEN
GIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSV
EIDVKKLAKSWRDNNKESKGTPPLNQLPNPAMPLLHRPTLKEMESSSLRSTSPDVGHFSN
FKSKSSGVSSPLLSRMKDYSNIVEPTLEDPTLKLKRISSFQEQPLNKLLKRETSQTAMLT
DHEDNIVAMSLTSMANSAASSPRLPLLRLNSSNELSNAQPLLDMTNNTLAFPRPNGPSGL
NPLLYISNKNISSISHSAPHSPVNPNISLIKRVKSPNIVTLNISRESSRSPIALNYEARQ
QHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHPERPNHKTANRILKKESPVETSKSN
LILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSS
GHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISNETTVDAPIMNPTVQ
PQDGKAAINQQSTPLS
Download sequence
Identical sequences A0A0L8VRL2 B3LRS9 C7GS41 H0GFH1
SCRT_04643 YER169W YER169W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]