SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL035C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL035C
Domain Number 1 Region: 46-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000029
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YGL035C
Sequence length 504
Comment MIG1 ORF Verified Transcription factor involved in glucose repression; sequence specific DNA binding protein containing two Cys2His2 zinc finger motifs; regulated by the SNF1 kinase and the GLC7 phosphatase
Sequence
MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIH
TGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRGRKKKVVGSPINSASSSATSI
PDLNTANFSPPLPQQHLSPLIPIAIAPKENSSRSSTRKGRKTKFEIGESGGNDPYMVSSP
KTMAKIPVSVKPPPSSALNNMNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIAS
SAPRTVFIDGPEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT
QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSSIDNLEQDYLQ
EQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFSSSSPDFQKELNNRLLNVQQQ
QQEQHTLLQSQNTSNQSQNQNQNQMMASSSSLSTTPLLLSPRVNMINTAISTQQTPISQS
DSQVQELETLPPIRSLPLPFPHMD
Download sequence
Identical sequences C7GT50
YGL035C YGL035C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]