SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL209W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL209W
Domain Number 1 Region: 31-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000108
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Weak hits

Sequence:  YGL209W
Domain Number - Region: 13-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0223
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGL209W
Sequence length 382
Comment MIG2 ORF Verified Protein containing zinc fingers, involved in repression, along with Mig1p, of SUC2 (invertase) expression by high levels of glucose; binds to Mig1p-binding sites in SUC2 promoter
Sequence
MPKKQTNFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSD
ELKRHMRTHTGQSQRRLKKASVQKQEFLTVSGIPTIASGVMIHQPIPQVLPANMAINVQA
VNGGNIIHAPNAVHPMVIPIMAQPAPIHASAASFQPATSPMPISTYTPVPSQSFTSFQSS
IGSIQSNSDVSSIFSNMNVRVNTPRSVPNSPNDGYLHQQHIPQQYQHQTASPSVAKQQKT
FAHSLASALSTLQKRTPVSAPSTTIESPSSPSDSSHTSASSSAISLPFSNAPSQLAVAKE
LESVYLDSNRYTTKTRRERAKFEIPEEQEEDTNNSSSSSNEEEHESLDHESSKSRKKLSG
VKLPPVRNLLKQIDVFNGPKRV
Download sequence
Identical sequences A6ZTY0 B3LHQ5 B5VIC4 C7GWY7 E7QEH0 N1P4I9
YGL209W YGL209W YGL209W tr|A6ZTY0|A6ZTY0_YEAS7 SCRT_01196 YGL209W YGL209W YGL209W YGL209W YGL209W YGL209W YGL209W YGL209W YGL209W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]