SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL254W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL254W
Domain Number 1 Region: 27-69
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000734
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 58-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000162
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Weak hits

Sequence:  YGL254W
Domain Number - Region: 10-35
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000222
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 259-285
Classification Level Classification E-value
Superfamily SH2 domain 0.0639
Family SH2 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YGL254W
Sequence length 299
Comment FZF1 ORF Verified Transcription factor involved in sulfite metabolism, sole identified regulatory target is SSU1, overexpression suppresses sulfite-sensitivity of many unrelated mutants due to hyperactivation of SSU1, contains five zinc fingers
Sequence
MTDIGRTKSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLR
VHKWTHSQIKPKACTLCQKRFVTNQQLRRHLNSHERKSKLASRIDRKHEGVNANVKAELD
GKEGGFDPKLPSGSPMCGEEFSQGHLPGYDDMQVLQCPYKSCQKVTSFNDDLINHMLQHH
IASKLVVPSGDPSLKESLPTSEKSSSTDTTSIPQLSFSTTGTSSSESIDSTTAQTPTDPE
SYWSDNRCKHSDCQELSPFASVFDLIDHYDHTHAFIPETLVKYSYIHLYKPSVWDLFEY
Download sequence
Identical sequences A0A0L8VRR6 B3LHU6 B5VI88 C7GP00 C8Z804 E7QEE0 Q2VQC1
YGL254W YGL254W YGL254W SCRT_01238 YGL254W YGL254W YGL254W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]