SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR067C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR067C
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000004
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGR067C
Sequence length 804
Comment ORF Uncharacterized Putative protein of unknown function; contains a zinc finger motif similar to that of Adr1p
Sequence
MAAGQKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHR
TFLLSSYASMTGDKTDIPVSLGVGDVDSTSPRDVKMETLVNSMIKVNSGLINIHYHSSNV
EKMDKPQRCVIGKESSSLKKGKSRFKQVKSRLESSISVKILQEYSLDFISSRDILTFFRM
GVSHLVENKIFQNFFPDLFSSLQNDELVESFWINKPFGLIIACLGMSISLNQDSQKLWFI
CCTNLYASSSKHDNDFDTEDILSQTEQHDVFALILFYSLLVMLENNIPVSNSIKKFDVFS
MLQDILKPFTVASSSYHYLNSKENAWFIFDLWVNILRDSNNFNNDSLLIFGWFVNQEFIS
SNSLKDFIYKGPSMSTTDLTLKHINILADSAYVYFIIKKTYPQELPSDFRVHDLLVYLNE
CFVMQQPIKPETSANPSLFANVMNARITDCKSKSNWLLWETIWFEFINNLTLRNGTTRNI
WFIDNFPQVSTSCLLHHSSSFVDETLITTNLSIISMLLNLKSFTLASLNSRNIQLITDIV
SFQLKLFSSELIASSDVSPSQVSQLLVNPNVHLMLYFWFDTIYVQRQSYLSSTEKEEFEK
VEVFVNDYIITHQKNLVTDLHSILFDFWSDSFIAYHILLHAIVSSLRDNILYPYLIYSPH
LNDQTKALSTDISNWSCFALQQPFRKTSRGSLSGASDMKSFSVASCLPLSPNFLKRDSNC
NKILLPPLDIKAIEPISTSNYTYVNSAPKQQEKEQPLLRATGNNINLVQTIVVPPQVNME
SQEFSASSTDNKQSKNIEIFSQIK
Download sequence
Identical sequences YGR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]