SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR071C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR071C
Domain Number - Region: 89-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000833
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 499-674
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0296
Family Hermes transposase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGR071C
Sequence length 860
Comment ORF Uncharacterized Putative protein of unknown function; deletion mutant has increased glycogen accumulation and displays elongated buds; green fluorescent protein (GFP)-fusion protein localizes to the nucleus
Sequence
MNTALDDLHGDLVTLEDNEIINNSDHSSSHSTSHEEEDEEEDDTEDIELIEKDGNKILSS
GIHPEDEIINDGLNIWIPVQMLKKNIAKFWSHFLAIEKKLTKVKCKHCGEILTRSDASLT
KTFRSHLKTKHNISANKNFYSMNFTVGDSNLKNNTSSTEITRRHGYDSLTFNSDQSFKCF
DIGKLQSSNYLSISQLVAIVIASENLPLNFFENVSFKSLLSKFHRIPPLTTNIIEESIIG
LSKSIDELIRRSISRNDTQLPFTIHLSDSKESNQPLYLKYSREIRAQLSNLDLSHLISVN
FTELAGKRSLFSLQLFDNTNKVSKVLPLSIFVRKTTDIDISVWQEQLNNLYSKYPGLQKS
VISITLPQSHYTMVLENRNSHNFTFHSGSVREIKYHTCIVSELLHCFLQPLFNVPTESML
SSFSVAKENHSGGSLLDSLIDFSHIDLSSTILGKICCLIEEVNLNDSLKSDFLLYCQNYT
QPNCNELTSILSCNCDRFSALKSILEKFANLVPFFKSINSHLENESLSESDFRLINTVEE
TLRTFEQSIEYFASSAPLKFTHTLVFIINFELYLTEIIRSFKFTKSKKPFEKILARLLKV
KDLYLLDDVNLIGAFLYPSIFQSKSLLNEIFGTTSVNKIVHNMTKIVLRYLKNFINVTNF
RSSNSGGESGRNSGNNLLSDYEAIFMKESRDVELLCNTKLTAPLTEDSLLVQIIRDDLLR
YVNRIAHELPNAYHDYLNDNDISFDGSHFTKHELSEENDSNSGEWCLNPMEETFDIHIPI
SDSIWNNYISSKNKIEVIDILLQLLSVNSTSSIRSELSSLTANQDFSTKLSEETIKIKLL
NSQFNLEKINFHSGSIFDAC
Download sequence
Identical sequences C7GXQ1
YGR071C YGR071C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]