SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR198W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR198W
Domain Number 1 Region: 465-561
Classification Level Classification E-value
Superfamily TPR-like 0.00000413
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  YGR198W
Domain Number - Region: 494-531,638-713
Classification Level Classification E-value
Superfamily TPR-like 0.00417
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGR198W
Sequence length 817
Comment YPP1 ORF Verified Cargo-transport protein involved in endocytosis; interacts with phosphatidylinositol-4-kinase Stt4; GFP-fusion protein localizes to the cytoplasm; YGR198W is an essential gene
Sequence
MPNSNVRIPPTVPSKIIDVVDQALRARLLGGSTFNSGFDSLDSVLNLQFRLHYHVIGSNG
PAKPVCDVLLKESQNLEKNMSMMEELNDYPEITKLVEKILFNCLGILFFHRGQFQESQRC
LLHSLKIHNNTASQRTALMEQYDRYLILENLYYRGLVSQDINIMQNVFYKGLLAHVDTIP
PESNGLLFEYISLIVAKLRFNQIQDLAENFKTTVENPFILFLYMIKKFQSPLKKHIDNDD
LYLKFGQKVLLKAKFPTASETNDEALEHFNVFLQYYFKFTHIKKIKVTPSWYNFIISSME
KTFQSIEVSKTAMFLFQNLSDNSNDEIKKKTFKRESILNFVNFVKYNDKYYQLHDNSHRD
IISFIDAYSFILQNSSKTDSIENVFDYDNTVSTFATSLNSFYKEYNLPLMSQSESLDWLE
NSTRCVYPGNISKVLTNAWSTLYEIRKYQLDFLVSNNLTSYLCNAMMLSTKEKDNADVEE
QEEGEEEKALRELQFKYSYTLAQQRHIETAIKTLESLILSKNPNYYKAWHLLALCRSVQE
DKEMSYKIVCSVLEAMNESLQNNTLLLNDRWQFIHLKLTQLALIEEIFGTLEALETLPEV
FELYATLFPDSQPKLNSMGPKYSQTKEYLLQMVWIFAANMYMRTKDNDEDAKAAIKEASN
VESKFKNLNCNIANGYLSIIKDEPGVALKEFETVLYYDENNLDALVGFAELIFPEELGVE
ETNLERYYTLSLDKKPGKRAKLTFVNDTDRSAAYARLKFLLECAILESIEAYYSPEVWWY
LSLIYEKYQDDEYKNSLLKCIKYQELNPIRSLRYCNY
Download sequence
Identical sequences C7GRN0
YGR198W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]