SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHL027W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHL027W
Domain Number 1 Region: 197-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000874
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 146-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000272
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YHL027W
Sequence length 629
Comment RIM101 ORF Verified Transcriptional repressor involved in response to pH and in cell wall construction; required for alkaline pH-stimulated haploid invasive growth and sporulation; activated by proteolytic processing; similar to A. nidulans PacC
Sequence
MVPLEDLPNKENGTAAPQHSRESIVENGTDVSNVTKKDGLPSPNLSKRSSDCSKRPRIRC
TTEAIGLKGQEDERMSPGSTSSSCLPYHSTSHLNTPPYDLLGASAVSPTTSSSSDSSSSS
PLAQAHNPAGDDDDADNDGDSEDITLYCKWDNCGMIFNQPELLYNHLCHDHVGRKSHKNL
QLNCHWGDCTTKTEKRDHITSHLRVHVPLKPFGCSTCSKKFKRPQDLKKHLKIHLESGGI
LKRKRGPKLGSKRTSKKNKSSASDAVSSCSASVPSGIAGSFKSHSTSPQILPPLPVGISQ
HLPSQQQQQQQQRAISLNQLCSDELSQYKPVYSPQLSARLQTILPPLYYNNGSTVSQGAN
SQSMNVYEDGCSNKTIANATQFFTKLSRNMTNNYILQQSSGSTESSSSSGRIPLAQTSYV
QPPNAPSYQSVQGGSSISATANTATYVPVRLAKYPTGPSLTEHLPPLHSNTAGGVFNRQS
QYAMPHYPSVRAAPSYSSSGCSILPPLQSKIPMLPSRRTMAGGTSLKPNWEFSLNQKSCT
NDIIMSKLAIEEVDDESEIEDDFVEMLGIVNIIKDYLLCCVMEDLDDEESEDKDEENAFL
QESLEKLSLQNQMGTNSVRILTKYPKILV
Download sequence
Identical sequences C7GIQ9
YHL027W YHL027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]