SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR006W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR006W
Domain Number 1 Region: 201-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000299
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YHR006W
Sequence length 541
Comment STP2 ORF Verified Transcription factor, activated by proteolytic processing in response to signals from the SPS sensor system for external amino acids; activates transcription of amino acid permease genes
Sequence
MPILSLSSTRNSVLTRIYDYLKALVQQVIVPNVEDDKSSKSTPFEKLEPAKQNHPQKDCC
ATEKDDLVDVSELFPKQNNKQLSLTSKSSVVPCALNLDNLETPFSIKIDNNGAVTTQLNL
DEPISRGPSRGEPAKLQNDLISSPPLEESYINNDQYKALFPSNFLPITPVSSVITPASKK
SIDESPLSDEVQGIADESSETLPYICHYCDARFRIRGYLTRHIKKHAKRKAYRCPFFDNS
ISQELRCHTSGGFSRRDTYKTHLKSRHFTYPEGVKPQDRNKSPGVCTQCGEYFSTSESWV
ENHIEAGSCKGLPEGYSEGIREKKKTSKMKMIKTSDGQTRFISSDESVSEPALQNKNCIE
ATVMQSKERPNDKIIPTKTEKNDFGIGTQWFERKQISRPTQTTQSRGPTEVQNFKEWSII
SPPILSPQNASSVPQEYQSSRYTLHMDSPALSSASSALSPLSGDPITTTETNKSYPLDSE
QSLLEPDKTEEDAINQSKESNMISINEMLQKQMDFELLGENHLKETQDYLALYKKAYGIE
F
Download sequence
Identical sequences A6ZSQ9 C7GMQ6
YHR006W tr|A6ZSQ9|A6ZSQ9_YEAS7 YHR006W YHR006W YHR006W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]