SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL056C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL056C
Domain Number 1 Region: 777-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 742-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000363
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 705-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000773
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 4 Region: 833-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000996
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YJL056C
Sequence length 880
Comment ZAP1 ORF Verified Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains
Sequence
MDALTPRDSPKRDDSMATSAATAASAKPDALTIGKEGIVHGHIHNYNNLTYIHGHLHHSA
PVNDSSASATPAAAAVADAATSAFASGASHEMGGDCHVNEKCKEYTDCQHFEFLNYHNNP
SLTKYNDTATYNSNNHTFANNLHSVASDPTNPQQNSKSDQPRRKDSWFNDDLILLPSSKK
NKPNPPPGSDDCYCTPKILEICCDETHPKSEANIKQGESDQPTKKDISENGNDVAIFTDV
KNDHLMPNFNLHDQYCNSTNHDSHNHNNTVPDSFSQLMSHLSEIDCDLTCDTPCTASTSA
TSSHKFVQDHQSSNNDDVFHKYCKFCEESTDNQPCSKHMHLESKSPQLPPKCSSLRKPTN
TLQGTNHAHHEHILNTDMDLKILEDLCNISSLYEVPFGKHINHHDHNNAGNGCDGSSTGN
NENGNQTMNLLLSSINRCNPKNNLNGSNNNTAGAPSTDHQHHHHRIQFHSHKPNRNNIVN
NSGISAANTTADLTNNDLNDLISREYSYERFRNQSEPPSLPKVTHQNQKNRRSWPTKDLE
STDFSSLEDSLPSSISPPIQTTSTINFNWCFKEEKNNDLKCKWKECPESCSSLFDLQRHL
LKDHVSQDFKHPMEPLACNWEDCDFLGDDTCSIVNHINCQHGINFDIQFANPDSLLPGSI
SKEKHHLLHCPNPQTHAVSKADGAPDMTSANDVSNIPPIKQPEQVICQWDGCNKSFSSAQ
ELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSE
ETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLS
KHIKTHQKKYKCSDCSKSFDDLGKLNSHKVKCALERKPYL
Download sequence
Identical sequences C7GR56
YJL056C YJL056C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]