SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL099W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL099W
Domain Number 1 Region: 338-404
Classification Level Classification E-value
Superfamily TPR-like 0.000000143
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Weak hits

Sequence:  YJL099W
Domain Number - Region: 270-346
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00816
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJL099W
Sequence length 746
Comment CHS6 ORF Verified Member of the ChAPs family of proteins (Chs5p-Arf1p-binding proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms the exomer complex with Chs5p to mediate export of specific cargo proteins, including Chs3p, from the Golgi to the plasma membrane
Sequence
MNLFWPSETKKQNEIPGGDYTPGNSPSVQKGYQFLNRDIFKSCPRIMERQFGECLHNRTH
LIKDLISSGNVGLGPIEIVHMSYLNKHEKEEFGEYFYVTGIEVSGPAMPVEFLEVLKSSK
RISKNISNNIILTYCCFNFFSNLDIRIRYDADDTFQTTAIDCNKETTDLTMTEKMWEETF
VSSVIRAIITNTNPELKPPGLVECPFYVGKDTISSCKKIIELLCRFLPRSLNCGWDSTKS
MQATIVNNYLMYSLKSFIAITPSLVDFTIDYLKGLTKKDPIHDIYYKTAMITILDHIETK
ELDMITILNETLDPLLSLLNDLPPRDADSARLMNCMSELLNIQTNFLLNRGDYELALGVS
NTSTELALDSFESWYNLARCHIKKEEYEKALFAINSMPRLRKNDGHLETMYSRFLTSNYY
KKPLNGTREHYDLTAMEFTNLSGTLRNWKEDELKRQVFGRIAMINEKKIGYTKEIWDDIA
IKLGPICGPQSVNLINYVSPQEVKNIKNINLIARNTIGKQLGWFSGKIYGLLMEIVNKIG
WNGLLNIRTEAFMMETEFYQASNNIVDENGHIPMESRKKRFCEGWLDDLFLDLYQDLKLS
KISLSNKDEKHSGLEWELLGLIMLRTWHWEDAVACLRTSIVARFDPVSCQQLLKIYLQPP
KNIQEVTLLDTDTIISLLIKKISYDCRYYNYCQIFNLQLLEKLCNELGTHILRNKILLQP
SIGDEIMVMIDAMLAWIADLDHTVQP
Download sequence
Identical sequences C7GR15
YJL099W YJL099W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]