SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR127C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR127C
Domain Number 1 Region: 148-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000399
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJR127C
Sequence length 1374
Comment RSF2 ORF Verified Zinc-finger protein involved in transcriptional control of both nuclear and mitochondrial genes, many of which specify products required for glycerol-based growth, respiration, and other functions
Sequence
MEPFAFGRGAPALCIRTAAARINLDNFVPCCWALFRLSFFFPLDPAYIRNENKETRTSWI
SIEFFFFVKHCLSQHTFFSKTLAPKRNFRAKKLKDIGDTRIDRADKDFLLVPEPSMFVNG
NQSNFAKPAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYL
CIFCGRCFARRDLVLRHQQKLNAALVGTGDPRRITPAPNSTSSFASKRRHSVAADDPTDL
HIIKIAGNKETILPTPKNLTGKTSEELKEAVVALAKSNNVELPVSSPVISDKREKTPPSK
AGSLEFREFKFSTKGVPVHSASSDAVIDRANTPSSMHKTKRHASFSASSAMTYMSSSNSP
HHSITNFELVEDAPHQVGFSTPQMTAKQLMESVSELDLPPLTLDEPPQAIKFNLNLFNND
PSGQQQQNSTSSTIVNSNNGSTVATPGVYLLSSGPSLTDLLTMNSAHAGAGGYMSSHHSP
FDLGCFSHDKPTVSEFNLPSSFPNTIPSNSTTASNSYSNLANQTYRQMSNEQPLMSLSPK
NPPTTVSDSSSTINFNPSTNNLLEPSMEPNDKDSNIDPAAIDDKWLSEFINNSDPKSTFK
INFNHFNDIGFIYSPPSSRSSIPSKSPPNHSATSLNHEKASLSPRLNLSLNGSTDLPSTP
QNQLKEPSYSDPISHSSHKRRRDSVMMDYDLSNFFSSRQLDISKVLNGTEQNNSHVNDDV
LTLSFPGETDSNATQKQLPVLTPSDLLSPFSVPSVSQLLFTNELRSMMLADNNIDSGAFP
TTSQLNDYVTYYKEEFHPFFSFIHLPSIIPNMDSYPLLLSISMVGALYGFHSTHAKVLAN
AASTQIRKSLKASEKNPETTELWVIQTLVLLTFYCIFNKNTAVIKGMHGQLTTIIRLLKA
SRLNLPLESLCQPPIESDHIMEYENSPHMFSKIREQYNAPNQMNKNYQYFVLAQSRIRTC
HAVLLISNLFSSLVGADCCFHSVDLKCGVPCYKEELYQCRNSDEWSDLLCQYKITLDSKF
SLIELSNGNEAYENCLRFLSTGDSFFYGNARVSLSTCLSLLISIHEKILIERNNARISNN
NTNSNNIELDDIEWKMTSRQRIDTMLKYWENLYLKNGGILTPTENSMSTINANPAMRLII
PVYLFAKMRRCLDLAHVIEKIWLKDWSNMNKALEEVCYDMGSLREATEYALNMVDAWTSF
FTYIKRGKRRIFNTPVFATTCMFTAVLVISEYMKCVEDWARGYNANNPNSALLDFSDRVL
WLKAERILRRLQMNLIPKECDVLKSYTDFLRWQDKDALDLSALNEEQAQRAMDPNTDINE
TIQLIVAASLSSKCLYLGVQILGDAPIWPIILSFAHGLQSRAIYSVTKKRNTRI
Download sequence
Identical sequences C7GM85
YJR127C YJR127C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]