SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR074C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR074C
Domain Number 1 Region: 35-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-17
Family HkH motif-containing C2H2 finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR074C
Sequence length 166
Comment BUD20 ORF Verified Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern
Sequence
MGRYSVKRYKTKRRTRDLDLIYNDLSTKESVQKLLNQPLDETKPGLGQHYCIHCAKYMET
AIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFLNRVQEITQSVGPEKESNE
ALLKEHLDSTLANVKTTEPTLPWAAADAEANTAAVTEAESTASAST
Download sequence
Identical sequences A0A250WM55 C7GQP9 G2WIR6 N1P6F1
YLR074C YLR074C YLR074C YLR074C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]