SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR298C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR298C
Domain Number 1 Region: 1-41,87-114
Classification Level Classification E-value
Superfamily PDB 2.85e-18
Family PDB 0.0000143
Further Details:      
 
Domain Number 2 Region: 1-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000997
Family HkH motif-containing C2H2 finger 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YLR298C
Sequence length 231
Comment YHC1 ORF Verified Component of the U1 snRNP complex required for pre-mRNA splicing; putative ortholog of human U1C protein, which is involved in formation of a complex between U1 snRNP and the pre-mRNA 5' splice site
Sequence
MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRG
RKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFV
DANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDETCESNPFPRLNNPKKLEPPKIL
SQWSNTIPKTSIFYSVDILQTTIKESKKRMHSDGIRKPSSANGYKRRRYGN
Download sequence
Identical sequences A0A0L8VL79 A7A1H9 B3RHH7 C7GVU1 N1NZZ4 Q05900
YLR298C YLR298C YLR298C YLR298C YLR298C YLR298C 5uz5_B 5zwn_R 6g90_C YLR298C YLR298C SCRT_04248 YLR298C 4932.YLR298C YLR298C YLR298C YLR298C tr|A7A1H9|A7A1H9_YEAS7 YLR298C YLR298C YLR298C YLR298C NP_013401.1.97178 YLR298C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]