SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR375W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR375W
Domain Number 1 Region: 153-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000144
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR375W
Sequence length 343
Comment STP3 ORF Verified Zinc-finger protein of unknown function, possibly involved in pre-tRNA splicing and in uptake of branched-chain amino acids
Sequence
MSNANNSAMNHITLPPISSFDNLIKAAERQYNGEASSASTHPTLPNMNISNGSGSAGASS
SMLSYQLLPHSNDVSRSNSSSSFLPSVQQPTEGSASASETSSSASPSRSISPILKVAGPS
SVGGAGVSTPHSTKINKPRKKKQCPICRNFYANLTTHKATHLTPEDRPHKCPICHRGFAR
NNDLLRHKKRHWKDEILSQSGVLSNHNDGKGGSVSPNDDDTHEKMTPMNSVTDYAQLKSL
HQIKGTFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEY
PPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHVGKQCGYKYH
Download sequence
Identical sequences A7A1Q1 B5VNR2 C7GRW7 E7KFY0 E7Q7A0 E7QIH2 Q05937
YLR375W YLR375W YLR375W YLR375W tr|A7A1Q1|A7A1Q1_YEAS7 YLR375W YLR375W YLR375W YLR375W NP_013479.3.97178 YLR375W YLR375W YLR375W YLR375W YLR375W YLR375W YLR375W YLR375W YLR375W 4932.YLR375W YLR375W YLR375W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]