SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR384C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR384C
Domain Number 1 Region: 141-171,239-424,553-604
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000000122
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 
Weak hits

Sequence:  YLR384C
Domain Number - Region: 853-1004
Classification Level Classification E-value
Superfamily ARM repeat 0.00896
Family HspBP1 domain 0.054
Further Details:      
 
Domain Number - Region: 991-1125
Classification Level Classification E-value
Superfamily TPR-like 0.0321
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR384C
Sequence length 1349
Comment IKI3 ORF Verified Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA; maintains structural integrity of Elongator; homolog of human IKAP, mutations in which cause familial dysautonomia (FD)
Sequence
MVEHDKSGSKRQELRSNMRNLITLNKGKFKPTASTAEGDEDDLSFTLLDSVFDTLSDSIT
CVLGSTDIGAIEVQQFMKDGSRNVLASFNIQTFDDKLLSFVHFADINQLVFVFEQGDIIT
ATYDPVSLDPAETLIEIMGTIDNGIAAAQWSYDEETLAMVTKDRNVVVLSKLYEPISEYH
LEVDDLKISKHVTVGWGKKETQFRGKGARAMEREALASLKASGLVGNQLRDPTMPYMVDT
GDVTALDSHEITISWRGDCDYFAVSSVEEVPDEDDETKSIKRRAFRVFSREGQLDSASEP
VTGMEHQLSWKPQGSLIASIQRKTDLGEEDSVDVIFFERNGLRHGEFDTRLPLDEKVESV
CWNSNSEALAVVLANRIQLWTSKNYHWYLKQELYGNDISYVKWHPEKDFTLMFSDAGFIN
IVDFAYKMAQGPTLEPFDNGTSLVVDGRTVNITPLAHANVPPPMYYRDFETPGNVLDVAC
SFSNEIYAAINKDVLIFAAVPSIEEMKKGKHPSIVCEFPKSEFTSEVDSLRQVAFINDSI
VGVLLDTDNLSRIALVDIQDITQPTLITIVEVYDKIVLLRSDFDYNHLVYETRDGTVCQL
DAEGQLMEITKFPQLVPDFRVKRVHNTSAEDDGNWSAESSELVAFGITNNGKLFANQVLL
ASAVTSLEITDSFLLFTTAQHNLQFVHLNSTDFKPLPLVEEGVEDERVRAIERGSILVSV
IPSKSSVVLQATRGNLETIYPRIMVLAEVRKNIMAKRYKEAFIVCRTHRINLDILHDYAP
ELFIENLEVFINQIGRVDYLNLFISCLSEDDVTKTKYKETLYSGISKSFGMEPAPLTEMQ
IYMKKKMFDPKTSKVNKICDAVLNVLLSNPEYKKKYLQTIITAYASQNPQNLSAALKLIS
ELENSEEKDSCVTYLCFLQDVNVVYKSALSLYDVSLALLVAQKSQMDPREYLPFLQELQD
NEPLRRKFLIDDYLGNYEKALEHLSEIDKDGNVSEEVIDYVESHDLYKHGLALYRYDSEK
QNVIYNIYAKHLSSNQMYTDAAVAYEMLGKFKEAMGAYQSAKRWREAMSIAVQKFPEEVE
SVAEELISSLTFEHRYVDAADIQLEYLDNVKEAVALYCKAYRYDIASLVAIKAKKDELLE
EVVDPGLGEGFGIIAELLADCKGQINSQLRRLRELRAKKEENPYAFYGQETEQADDVSVA
PSETSTQESFFTRYTGKTGGTAKTGASRRTAKNKRREERKRARGKKGTIYEEEYLVQSVG
RLIERLNQTKPDAVRVVEGLCRRNMREQAHQIQKNFVEVLDLLKANVKEIYSISEKDRER
VNENGEVYYIPEIPVPEIHDFPKSHIVDF
Download sequence
Identical sequences C7GXI8
YLR384C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]