SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR387C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR387C
Domain Number - Region: 175-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000294
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0408
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 228-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.068
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR387C
Sequence length 432
Comment REH1 ORF Verified Cytoplasmic 60S subunit biogenesis factor, associates with pre-60S particles; similar to Rei1p and shares partially redundant function in cytoplasmic 60S subunit maturation; contains dispersed C2H2 zinc finger domains
Sequence
MSSTFFTCNCCVIQFKTSDLQRYHMKTEWHRYNLKRRIANLPPIGAEQFAEKLQISEKEQ
AENQVDEFGFPVLKPVMNQSNALPQKQKKLIKSKRGRKVGTNLLKRKDRDIAKEKQNRSV
SPSGSISSQLSNLTVGTENTNTDYGEDTVSEYGFTSDSNYEYATSDEELDIADKPSDKEN
EKITITECIYCGKDNKEVERNVKHMFSEHGLFIPERSYLIDLNGLLEFLIKMIVIDHNCL
CCNFHGSGLESIRAHMASKRHCRLPYETKEERQLFAPFYDFTYDDHSISKNLQNDRAITS
KLSSVYGAKNDEEDGEVDITLVSSENDINANYTTVSIDESGLELTLPTGARLGHRAGQRY
YRQNLPSQPNPNESRRTITAADRRMVSGVTEKQYKKGMKKMQQLEKNAINTQIRREIKRV
NFQTHYRDELLQ
Download sequence
Identical sequences C7GXJ1
YLR387C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]