SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR403W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR403W
Domain Number 1 Region: 596-622,654-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000056
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  YLR403W
Domain Number - Region: 524-555
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family GUN4-associated domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YLR403W
Sequence length 683
Comment SFP1 ORF Verified Transcription factor that controls expression of ribosome biogenesis genes in response to nutrients and stress, regulates G2/M transitions during mitotic cell cycle and DNA-damage response, modulates cell size; regulated by TORC1 and Mrs6p
Sequence
MDFTTMTMASNMATSTTTTATSAHASINSSSNSNIDIDSNQNTPSILINNNSDSSNGKNT
DFNGVNNIHQKNITNNTNNVHLYSPNIMDQTLLTPQDIAKLRRESIAHSQGMGGVSWGSI
SVGSWLRDEIISRRSSIVPASANGAASAAASATTTATNTLQIQQPTKRPSVSNLPYHRGY
SISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQIPMN
SAGNTSSSVRMTNNTSSANYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANL
QSNMDSNSTIRQSQHPHHQQNIIQQQLQSNSVNHTSGAVPTPSVMGSATASSTTANPNVI
SITGAPNSGLSMANHSQQLHLNGNLVDAVSTNDVFLRTSNSPSRHVPHNKQINSNNNSGI
IINNNTSHNSNINMGSKNAMVNRPHTFNNYSLNKTSRNPIQHQSRKIDPHQTDLSPLVLV
QDIDLSFMDDDILGPSNHNSMNSVVNPTTGSHNYNTFHSSVHAKSSQNMVEDQDIDDIDD
DDDVDDDDDDDDDDDTENGSSSNGKSVHNNNYKMPQQAYIDDPARRLYVMDHEEQKPFKC
PVIGCEKTYKNQNGLKYHRLHGHQNQKLHENPDGTFSVIDPDSTDSFGDGMGSAKDKPYR
CEVCGKRYKNLNGLKYHRGHSTH
Download sequence
Identical sequences C7GXK5
YLR403W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]