SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML046W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML046W
Domain Number 1 Region: 77-484
Classification Level Classification E-value
Superfamily TPR-like 2.28e-26
Family HAT/Suf repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YML046W
Sequence length 629
Comment PRP39 ORF Verified U1 snRNP protein involved in splicing, contains multiple tetriatricopeptide repeats
Sequence
MPDETNFTIEDIEPRPDALRGLDTQFLHDNTALVQAYRGLDWSDISSLTQMVDVIEQTVV
KYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPT
SLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNV
QRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIILRKTQTTVNEIWQFESKIKQ
PFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWL
TKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLK
IWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSISNYINNQIDAKVH
LQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKS
NVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILY
PELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPI
SLPNFRNLEKINQVKINDLYTEEFLKEGK
Download sequence
Identical sequences C7GS62 C8ZEG3
YML046W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]