SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML081W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML081W
Domain Number 1 Region: 58-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000583
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YML081W
Sequence length 1251
Comment ORF Uncharacterized Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nucleus; YML081w is not an essential gene
Sequence
MSSEEFKGLPIKRDISSTIYADRPPALSAPPCVGATGNDKIQVLPIPKKSRTIKTDKPRP
FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKES
INSKDKTEIDAINDKNIIQIQGNKQTILPTPSNPLAKTAAQLKKAAKEKKNGKQGKLDLS
PSYRANNHSTDVSPSVGNSSTPAVIEETDSSSHFPLPDTNIPTKSKRHASFSASSAFTYS
SDNFQKLHQQAKSDFDELQESIPHQVGFSTPQLTAQQLIENAIESGVVDLETLDLPPFLS
LDGLPPASSSTAVAASEQIDICPSSATDTISGANSTPNQAATAPPFQLPIARESSSLFLA
NTPYLSDFLTMGSSYGGSGGFAKSITADPSLDYFNYKNHSHPDSRHNNSSSGINYSNNKN
NNESIEKSQNNSNVINETIDHTDIHAHHADAHDDSFIESEEWLSKFIMDSQIDNDLKLNI
NHFNDIGFNNLHPQNPTTHSEPRNMHNENRDMHRSASKFQSVSENISPREQMSLFKTKQN
KAISKFLSDEKIPSTASPSSSASPVQFDKKNVDINEFLLDESVSNLFTTRQIDLFKKNVN
LYSPLFQNQKDAVSSTSLTPSLTTQTATTQSGPGWTDSSQKLTFFTEQLRNLIIKENNLK
SNLFPTVDELNHYVDLYQVEFHKYFPFIHLYSIIPSSENYPLVISISMIGALYGFHSTHA
LLLSKIARTRVRMFLENTRSNHDKTPIWLMQSLVLLTFTSIFSNDMNAFRTVNTQIMILV
QLIKISKLNYPLENFIKPPIESDHVLEYQDNPAVLNQFKAQYNTREQINRNFKYFILAQS
RIRICHIVLLISNLFKSLVDFDCCFHSIDLKCGVPCYNEVLFFCENSRTWNENLTRFNIV
LDSKFSLIEVSNGESNYEKCLMYLSNGNPYLYKNAKISFKTLLSLLISIHEKINIERDAL
KDSDESDFHAKNVQWRMHSRPLVATMLKHWELLYIKNGGILALSDENLPIINTNPSFRLI
IPLYFFAKLRKCLDIAPTLRCIWNQDWNSMNSSLEKVCYEWESLREATEYAVSVITFWID
TVSVMKGKSTQTPIFTITCIFVSILVIAGYMRRLEDFAQNKNSDCMIGSLKSTDRILWLK
AFKTLKRIESHLSEREYKLQTFAEFLRVPDNGSLDIESLDSSLIENTLNSHDVTNQALDI
ITRTRLSSRTLYCGARILGDTPVWPVSLLFAHALQSRAIYNINHRKSVNSV
Download sequence
Identical sequences A0A0L8VKZ8 A6ZLY4 B3LLH5 C7GW16
YML081W SCRT_01817 YML081W YML081W tr|A6ZLY4|A6ZLY4_YEAS7 YML081W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]