SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR070W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR070W
Domain Number 1 Region: 178-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000164
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR070W
Sequence length 322
Comment MOT3 ORF Verified Nuclear transcription factor with two Cys2-His2 zinc fingers; involved in repression of a subset of hypoxic genes by Rox1p, repression of several DAN/TIR genes during aerobic growth, and repression of ergosterol biosynthetic genes
Sequence
MNSNAAAAAYYSFPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNNGNNAANNGSNNSS
HSAPAPAPGPPHHHHHHSNTHNNLNNGGAVNTNNAPQHHPTIITDQFQFQLQQNPSPNLN
LNINPAQPLHLPPGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHKYIHQC
QFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKN
NIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIKTLIN
DGVLNKDDVKRVLNNLIVSHNK
Download sequence
Identical sequences YMR070W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]