SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL027W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL027W
Domain Number 1 Region: 564-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Weak hits

Sequence:  YNL027W
Domain Number - Region: 600-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00011
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 105-183
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0162
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YNL027W
Sequence length 673
Comment CRZ1 ORF Verified Transcription factor that activates transcription of genes involved in stress response; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation
Sequence
MSFSNGNMASYMTSSNGEEQSINNKNDIDDNSAYRRNNFRNSSNSGSHTFQLSDLDLDVD
MRMDSANSSEKISKNLSSGIPDSFDSNVNSLLSPSSGSYSADLNYQSLYKPDLPQQQLQQ
QQLQQQQLQQQQQKQTPTLKVEQSDTFQWDDILTPADNQHRPSLTNQFLSPRSNYDGTTR
SSGIDSNYSDTESNYHTPYLYPQDLVSSPAMSHLTANNDDFDDLLSVASMNSNYLLPVNS
HGYKHISNLDELDDLLSLTYSDNNLLSASNNSDFNNSNNGIINTADTQNSTIAINKSKVG
TNQKMLLTIPTSSTPSPSTHAAPVTPIISIQEFNEGHFPVKNEDDGTLQLKVRDNESYSA
TNNNNLLRPDDNDYNNEALSDIDRSFEDIINGRKLKLKKSRRRSSQTSNNSFTSRRSSRS
RSISPDEKAKSISANREKLLEMADLLPSSENDNNRERYDNDSKTSYNTINSSNFNEDNNN
NNLLTSKPKIESGIVNIKNELDDTSKDLGILLDIDSLGQFEQKVGFKNDDNHENNDNGTF
SVKKNDNLEKLDSVTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKA
FARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRRCITPL
YEEARQEKSGQES
Download sequence
Identical sequences C7GWP5
YNL027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]