SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL125W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOL125W
Domain Number - Region: 71-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00118
Family CHHC finger 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOL125W
Sequence length 476
Comment TRM13 ORF Verified 2'-O-methyltransferase responsible for modification of tRNA at position 4; C-terminal domain has similarity to Rossmann-fold (RFM) superfamily of RNA methyltransferases
Sequence
MLQDNNGPAVKRAKPSERLQCEYFMEKKKRRCGMTRSSQNLYCSEHLNLMKKAANSQVHN
KNGSEAEKERERVPCPLDPNHTVWADQLKKHLKKCNKTKLSHLNDDKPYYEPGYNGENGL
LSSSVKIDITAEHLVQSIELLYKVFEGESMDELPLRQLNNKLMSLKRFPQLPSNTKHAVQ
QSSLIENLVDAGAFERPESLNFIEFGCGRAEFSRYVSLYLLTQLTSLPAEHSGSNSNEFV
LIDRATNRMKFDKKIKDDFSEIKSNSPSKPISCPSIKRIKIDIRDLKMDPILKSTPGDDI
QYVCISKHLCGVATDLTLRCIGNSSILHGDDNNGCNPKLKAICIAMCCRHVCDYGDYVNR
SYVTSLVEKYRAHGSILTYETFFRVLTKLCSWGTCGRKPGTAITDIVNVVESFEGAEPYT
ITIKERENIGLMARRVIDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAMLVYKK
Download sequence
Identical sequences A0A0L8VHW7 A6ZN86 B3LIU1 C7GV02 E7QKB0 N1NYR0 Q12383
YOL125W tr|A6ZN86|A6ZN86_YEAS7 4932.YOL125W YOL125W NP_014516.1.97178 YOL125W YOL125W YOL125W YOL125W YOL125W YOL125W SCRT_01281 YOL125W YOL125W YOL125W YOL125W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]