SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL145C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL145C
Domain Number 1 Region: 186-413
Classification Level Classification E-value
Superfamily HCP-like 1.05e-17
Family HCP-like 0.014
Further Details:      
 
Domain Number 2 Region: 677-857
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000313
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 3 Region: 436-625
Classification Level Classification E-value
Superfamily TPR-like 0.000000000976
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number 4 Region: 53-160
Classification Level Classification E-value
Superfamily TPR-like 0.00000348
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOL145C
Sequence length 1077
Comment CTR9 ORF Verified Component of the Paf1p complex that binds to and modulates the activity of RNA polymerases I and II; required for expression of a subset of genes, including cyclin genes; contains TPR repeats
Sequence
MTNAMKVEGYPSMEWPTSLDIPLKASEELVGIDLETDLPDDPTDLKTLLVEENSEKEHWL
TIALAYCNHGKTNEGIKLIEMALDVFQNSERASLHTFLTWAHLNLAKGQSLSVETKEHEL
TQAELNLKDAIGFDPTWIGNMLATVELYYQRGHYDKALETSDLFVKSIHAEDHRSGRQSK
PNCLFLLLRAKLLYQKKNYMASLKIFQELLVINPVLQPDPRIGIGLCFWQLKDSKMAIKS
WQRALQLNPKNTSASILVLLGEFRESFTNSTNDKTFKEAFTKALSDLNNIFSENQHNPVL
LTLLQTYYYFKGDYQTVLDIYHHRILKMSPMIAKIVLSESSFWCGRAHYALGDYRKSFIM
FQESLKKNEDNLLAKLGLGQTQIKNNLLEESIITFENLYKTNESLQELNYILGMLYAGKA
FDAKTAKNTSAKEQSNLNEKALKYLERYLKLTLATKNQLVISRAYLVISQLYELQNQYKT
SLDYLSKALEEMEFIKKEIPLEVLNNLACYHFINGDFIKADDLFKQAKAKVSDKDESVNI
TLEYNIARTNEKNDCEKSESIYSQVTSLHPAYIAARIRNLYLKFAQSKIEDSDMSTEMNK
LLDLNKSDLEIRSFYAWYLKNSKERKNNEKSTTHNKETLVKYNSHDAYALISLANLYVTI
ARDGKKSRNPKEQEKSKHSYLKAIQLYQKILQVDPFNIFAAQGLAIIFAESKRLGPALEI
LRKVRDSLDNEDVQLNLAHCYLEMREYGKAIENYELVLKKFDNEKTRPHILNLLGRAWYA
RAIKERSVNFYQKALENAKTALDLFVKESSKSKFIHSVKFNIALLHFQIAETLRRSNPKF
RTVQQIKDSLEGLKEGLELFRELNDLKEFNMIPKEELEQRIQLGETTMKSALERSLNEQE
EFEKEQSAKIDEARKILEENELKEQERMKQEEEARRLKLEKQAEEYRKLQDEAQKLIQER
EAMAISEHNVKDDSDLSDKDNEYDEEKPRQKRKRSTKTKNSGESKRRKAAKKTLSDSDED
DDDVVKKPSHNKGKKSQLSNEFIEDSDEEEAQMSGSEQNKNDDNDENNDNDDNDGLF
Download sequence
Identical sequences A6ZN67 B3LIS2 B5VRB7 C7GV20
tr|A6ZN67|A6ZN67_YEAS7 YOL145C YOL145C SCRT_01262 YOL145C YOL145C YOL145C YOL145C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]