SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR057W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR057W
Domain Number 1 Region: 185-283,320-375
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.15e-20
Family GS domain 0.007
Further Details:      
 
Domain Number 2 Region: 10-144
Classification Level Classification E-value
Superfamily TPR-like 0.0000486
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR057W
Sequence length 395
Comment SGT1 ORF Verified Cochaperone protein; regulates activity of adenylyl cyclase Cyr1p; involved in kinetochore complex assembly; associates with the SCF (Skp1p/Cdc53p/F box protein) ubiquitin ligase complex; acts as a linker between Skp1p and HSP90 complexes
Sequence
MPVEKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWHS
DATMENAKELLDKALMTAEGRGDRSKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYV
DDTLPLWEDRLETKLNKKNKKQKDSTNKHTIKPVESIENRGDNNSSHSPISPLKIETAPQ
ESPKFKIDWYQSSTSVTISLFTVNLPESKEQVNIYISPNDRRTLSISYQVPKSGSEFQYN
AKLSHEVDPKAVSLKIFPKKLEITLSKIDSTQWKKLEEDILTESSRLSDEGKNSDSATRL
LSAETASKERLSYPSSSKKKIDWSKLDIDEEADEEAGSADSFFQKLYAGADPDTKRAMMK
SFIESNGTALSTDWEDVSKGTVKTSPPEGMEPKHW
Download sequence
Identical sequences C7GSN0 N1NVR5 Q08446
YOR057W 355524 4932.YOR057W YOR057W YOR057W NP_014700.1.97178 YOR057W YOR057W YOR057W YOR057W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]