SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR113W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR113W
Domain Number 1 Region: 603-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.93e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 644-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000696
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR113W
Sequence length 915
Comment AZF1 ORF Verified Zinc-finger transcription factor, involved in induction of CLN3 transcription in response to glucose; genetic and physical interactions indicate a possible role in mitochondrial transcription or genome maintenance
Sequence
MPPPTAQFMGPTQAGQNESQNQSSGEAGEQNQEHGQGPTPILNQSQPASSQPQHQQQRNE
SISYYTNFNQPRYSTDASINSFLNISDNVPVTSTGGPSSGGAYSNLPRLSTSSTHQPPDL
SQIGRGFSIVNNLFPQQQQLQNQHRQQQQQQQQQSHQQPPFKTPSFSTGLTGSSSQYQFL
PRNDNTSQPPSKRNSVYLGPNDGPDFEFFSMQQSQQPQFQPSSRRESNSMRPPLLIPAAT
TKSQSNGTNNSGNMNTNADYESFFNTGTNNSNSNQNPYFLSSRNNSLKFNPEDFDFQFKR
RNSFVRGTLDHSSQNAFIPESRLNSLSVNNKANGDPVADNVTNNMKGKSNEVDNDDGNDS
SNNNNNNNNNNNNNENNNDNNNDNNDNSINSATSTNIPNQEDHSLASTDTTSNSRKDLKE
IEQRLRKHLNDEDNYSSAISRPLDKNDVIDGSEGLNKHIDESGMQPNIIKKRKKDDSTVY
VKNEMPRTDPPMSKDNSTSAEGAAMANFSGKEPPIPDISLVSDDATNLIGATKVDQLMLI
IQARKKGFTEKVNTTQDGDLLFNQTMDILPPKSELVGGVEKPKGTQNTRAVKKHECPYCH
RLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFS
RKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETLNALTAKLAEMNPS
ENIPLEERQLLEYFASIYKNSNRGIKGRGKGVGTKKSTISSPENHPASTILNPNTNANNA
IANDSENNGNPEGNIDSSSNSNPGSHSMISPTQKDMGTLQSQFIQNNFNNSVNSSNPSNQ
PIINYNYTTLPHSRLGSSSSSNTNNNNSNFSVGAAPGVLMAPTTNNDFSFNLDQSNDNER
SQQEQVRFKNINYKS
Download sequence
Identical sequences C7GMM3
YOR113W YOR113W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]