SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR274W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR274W
Domain Number 1 Region: 16-160
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000111
Family Shikimate kinase (AroK) 0.065
Further Details:      
 
Weak hits

Sequence:  YOR274W
Domain Number - Region: 370-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00186
Family HkH motif-containing C2H2 finger 0.039
Further Details:      
 
Domain Number - Region: 12-52,179-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0104
Family Shikimate kinase (AroK) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR274W
Sequence length 428
Comment MOD5 ORF Verified Delta 2-isopentenyl pyrophosphate:tRNA isopentenyl transferase, required for biosynthesis of the modified base isopentenyladenosine in mitochondrial and cytoplasmic tRNAs; gene is nuclear and encodes two isozymic forms
Sequence
MLKGPLKGCLNMSKKVIVIAGTTGVGKSQLSIQLAQKFNGEVINSDSMQVYKDIPIITNK
HPLQEREGIPHHVMNHVDWSEEYYSHRFETECMNAIEDIHRRGKIPIVVGGTHYYLQTLF
NKRVDTKSSERKLTRKQLDILESTDPDVVYNTLVKCDPDIATKYHPNDYRRVQRMLEIYY
KTGKKPSETFNEQKITLKFDTLFLWLYSKPEPLFQRLDDRVDDMLERGALQEIKQLYEYY
SQNKFTPEQCENGVWQVIGFKEFLPWLTGKTDDNTVKLEDCIERMKTRTRQYAKRQVKWI
KKMLIPDIKGDIYLLDATDLSQWDTNASQRAIAISNDFISNRPIKQERAPEALEELLSKG
ETTMKKLDDWTHYTCNVCRNADGKNVVAIGEKYWKIHLGSRRHKSNLKRNTRQADFEKWK
INKKETVE
Download sequence
Identical sequences A0A0L8VHT7 B3LJU0 B5VSF5 C7GWB6
YOR274W YOR274W YOR274W YOR274W YOR274W YOR274W YOR274W SCRT_01656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]