SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL038W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL038W
Domain Number 1 Region: 91-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000644
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPL038W
Sequence length 177
Comment MET31 ORF Verified Zinc-finger DNA-binding protein, involved in transcriptional regulation of the methionine biosynthetic genes, similar to Met32p
Sequence
MKLAQDMNVDEIFLKQAAEAIAVISSSPTHTDPIIRELLHRIRQSSPLSAVIPAPENVLK
AGEPENMARGLIRIPETQTKRTGGNNHSKEGAQLYSCAKCQLKFSRSSDLRRHEKVHSLV
LPHICSNCGKGFARKDALKRHSNTLTCQRNRKKLSEGSDVDVDELIKDAIKNGTGLL
Download sequence
Identical sequences A6ZWL0 C7GU16 G2WPE1 N1NW52 Q03081
YPL038W YPL038W YPL038W YPL038W YPL038W YPL038W YPL038W NP_015287.1.97178 4932.YPL038W YPL038W YPL038W YPL038W tr|A6ZWL0|A6ZWL0_YEAS7 YPL038W YPL038W YPL038W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]