SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL210C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL210C
Domain Number 1 Region: 114-152,182-265
Classification Level Classification E-value
Superfamily TPR-like 0.00000000313
Family Tetratricopeptide repeat (TPR) 0.049
Further Details:      
 
Weak hits

Sequence:  YPL210C
Domain Number - Region: 14-78,117-154
Classification Level Classification E-value
Superfamily TPR-like 0.00372
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPL210C
Sequence length 640
Comment SRP72 ORF Verified Core component of the signal recognition particle (SRP) ribonucleoprotein (RNP) complex that functions in targeting nascent secretory proteins to the endoplasmic reticulum (ER) membrane
Sequence
MAKDNLTNLLSQLNIQLSQDEHSQVEQTCVKLLDSGCENPANVFRRCLVAVIQQDKYQKA
LHYLKKFKHIDDKYGRKFALEKLYIFYKLNMPDEFNTLYTAIITDDLDTVLKKDIESLRG
ILHVRAQYCYKNGLYQEAFKIYQHLASHNEKDQDSQIELSCNERVPLSVATELMNRSPLV
TPMDESSYDLLFNESFIMASVGKYDKAIELLEKALQGATNEGYQNDINTIKLQLSFVLQM
VGKTAQSKEILKGLLQELKADSPFSLICQNNLNAFVDFSKYNTNFNLLLRELNVEKLNTF
NLQTFTHEQWSNIQRNVLFLRLFNNVKIHSQESLLSRTFDKYSKLVDNVTLESYKTQAKK
LYHHTTKTILSGTDGSTIGILLLTIQLLIIEKEWENAIRIGELFLNESWKSSFEKFNDSQ
AIVCYILFELYKIKGRNNSKSVLLKKLGSVRVQLSGKIQENIPFWKHVGFELLSMGNAKE
SKALLREISNFSKGDADVLVDRVVSSDSLDIAQGIDLVRDIDIDKLIQLGVKPLESSAKR
SKNTAVSKVQKRKVLELKKKRKIKRLEKFLQGRDTSKLPDPERWLPLRDRSTYRPKKKQQ
GAKQTQGGAMNKKSEQALDISKKGKPTVNKKPKNKKKGRK
Download sequence
Identical sequences C7GN37
YPL210C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]