SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL230W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL230W
Domain Number 1 Region: 46-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000286
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPL230W
Sequence length 392
Comment USV1 ORF Verified Putative transcription factor containing a C2H2 zinc finger; mutation affects transcriptional regulation of genes involved in growth on non-fermentable carbon sources, response to salt stress and cell wall biosynthesis
Sequence
MENTTNRNTAGVLTSSNGNFATNSVAASTPKRSKSARRKTFKCTGYDGCTMSFTRAEHLA
RHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKNHHSTSSHQRKPSSSSLSSSSS
ASSSSSASSSTSYSDPYRKTNINSGNMPMMAENEKAPQIIHSSPEFITSTRSIPPISPRS
IYNTQRQQQHQQQQQHQQAPYYFPSHPITDSYYQYPLPSNNNTINYLPSVDVQYPLNVSP
SSMSHSASEVIISSFPPRSMPSTSFKYKDSADFQARTTMNKYNIRPSNINVNTSNINNNL
DSFSPPFSPSTTVAEAKPIILPQYQQAFSQPPNRNKNNNMSSSKNGGKGGENFKNTDDRN
DNNNEKRSETLSESDISVNTNKKRLSVDYILT
Download sequence
Identical sequences C7GU69
YPL230W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]