SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR013C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR013C
Domain Number 1 Region: 266-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000162
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 241-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000032
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPR013C
Sequence length 317
Comment ORF Uncharacterized Putative zinc finger protein; YPR013C is not an essential gene
Sequence
MNFSLSKQSSEKQSSYTDKSRSPNIGMCTVNYKSNLPLQVSAVDQLSTGKGTQFYGHNSY
KNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPI
SMNATSDQYPIYYTESQQPIPHSQPPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASE
PNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSD
WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML
RHLKSHERKRNKVLNTT
Download sequence
Identical sequences A0A0L8VFZ1 B3LL73 C7GV38 E7KJE8 E7QLS5
SCRT_02502 YPR013C YPR013C YPR013C YPR013C YPR013C YPR013C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]