SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR015C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR015C
Domain Number 1 Region: 186-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000025
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPR015C
Sequence length 247
Comment ORF Uncharacterized Putative protein of unknown function; overexpression causes a cell cycle delay or arrest
Sequence
MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSSIMHAPLTPEINQ
AALPPPAYHYAPSSLHQTEDPVWRSSPNSIIFSPVIATPEPFPLTFVERQSCCPIYSTAA
SSYTAESVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPGTLLSQTQTDLDLIQKQLRAV
VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK
ITKKKHQ
Download sequence
Identical sequences C7GV39
YPR015C YPR015C YPR015C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]