SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR022C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR022C
Domain Number 1 Region: 35-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000279
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPR022C
Sequence length 1134
Comment ORF Uncharacterized Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and the nucleus and is induced in response to the DNA-damaging agent MMS
Sequence
MHGKELAGRLRKRENDNDLSPNSSSSPAERFRCPHPECNKTFSRQEHLSRHKLNHWPKEI
YVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSKVKNRLSRPSKDQISSSNKDFSKNAPYN
PSEVPLSTQSGTSTINLIKNSVNPPPSITQESKFRPFLQQPQQPQQIQQSQQPQQIQQLQ
QLQFPQQLRAPLQQPMLQQQMHPQQASPTFPSYDPRIRNNGQNGNQFFNLIFDNRTGVNG
FEVDAANNNGNGNDQNMNINPAVQQQRYQDRNFASSSYQQPLQPLTQDQQQEQYFQQQKL
AQQQQQQQQQQQQQQQQLPPQNPFGDPLTSSSSGANLSVMQDLFSTNFLNSDPLQSFMQE
LSEAPQVSIEDTFSDKNTIPPNEKPVQQDEGFQNPPVMFELPQDNIKIPKAQPKFNDNPS
TSVKDNLSSQKLNINELKRRSSKDSGVGNNSSLNYKEQLRHSMKSVPSFFHPDPLTKYKI
SKEKCQEMFSFVPELRYVSIESIHKSLKSFWLNFHPQYGLLHKPSFHVDKQPAILNLALI
MTGASFLGSEYREQISDPICGPLRWIIFSHADFQPPSKTYIIQSLLLVEGYEKTSTNRYL
HERSFLHHGTTIQLLRRTPSLGGHPLMVKTGKTSGENSIQDPQEVYKRWIDFEMLKRIAF
YAFYMDTTHAVVFGYWNLFINSNQIQLTLPCPDQVWESYDLSYETLMEHGYGSTKRDENN
TFLSALMQLMKNVIQILRNNNIRRNKVNNGGIESTPTDLESTADWNIQSLFGKKILLAGI
ISILFQCQEEVNGDYFITNFRGGITDHLGLSWKDILSFAMNYWLHEVQKSCTDPKACRIS
TPSEETLTNRKIDEDNGDGLCDDDLDLLSSDNPSNCKIPVIHISQIVLRILHHDYYIYAG
APWRMNVPIGRDEYDMISRRILQFAKDPYNGGVAVVYAFQFLFEMFIIKENNVPTVVKSY
NINSDPVITRPYAIALTSLLIWSCNFALHGCEVSIWDNTEASKDECFQPDDSNGGNILGN
TDNNGSTIANNNLKEKNNYIPIESFEVYLLRMYRNLYVDSSLDVVSFQNEVWAKASLLQH
ISNTHFLCGMMQFMRDIFNKSYWDLGREFGKLFDNCLERSLGKTSPTCHNMFDV
Download sequence
Identical sequences C7GQB6
YPR022C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]