SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR170C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR170C
Domain Number 1 Region: 815-1009
Classification Level Classification E-value
Superfamily Sec7 domain 4.58e-73
Family Sec7 domain 0.00000344
Further Details:      
 
Domain Number 2 Region: 1343-1502,1531-1687
Classification Level Classification E-value
Superfamily ARM repeat 0.000000455
Family HEAT repeat 0.092
Further Details:      
 
Weak hits

Sequence:  YDR170C
Domain Number - Region: 1544-1733,1809-1995
Classification Level Classification E-value
Superfamily ARM repeat 0.000518
Family Armadillo repeat 0.084
Further Details:      
 
Domain Number - Region: 228-394
Classification Level Classification E-value
Superfamily ARM repeat 0.00493
Family HspBP1 domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR170C
Sequence length 2006
Comment SEC7 ORF Verified Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles
Sequence
MSEQNSVVNAEKGDGEISSNVETASSVNPSVKPQNAIKEEAKETNGEDQKCKGPENAGST
AETKETSNDATNGMKTPEETEDTNDKRHDDEGEDGDEDEDEDEDEDEDNGDEDDEDVDSS
SSETSSEDGEDSESVSGESTESSSGEDEESDESDGNTSNSSSGDESGSEEEEEEEEEEEN
AGEPAIAHQDSVPTNDSTAPRSTHTRNISLSSNGSNTNSTIILVKTTLETILNDKDIKKN
SNAQKAIERTLQKFKEFDPQTTNNPHYVDSILVFEALRASCRTKSSKVQSLALDCLSKLF
SFRSLDETLLVNPPDSLASNDQRQDAADGITPPPKQKIIDAAIDTISDCFQGEGTDDRVE
LQIVRALSSCILEEDSSSLCHGASLLKAIRTIYNVFVFSLNPSNQGIAQATLTQIISSVY
DKIDLKQSTSSAVSLSTKNHQQQSAIELSEASENAETPAPLTLENMDKLNDDEERLMDAQ
QPDSIAITNQDLAVKDAFLVFRVMAKICAKPLETELDMRSHAVRSKLLSLHIIYSIIKDH
IDVFLSHNIFLPGKERVCFIDSIRQYLRLVLSRNAASPLAPVFEVTLEIMWLLIANLRAD
FVKEIPVFLTEIYFPISELTTSTSQQKRYFLSVIQRICNDPRTLVEFYLNYDCNPGMPNV
MEITVDYLTRLALTRVEITQTQRSYYDEQISKSLSTYNFSQLPLLTSSNLSSSPDVGQVN
LLFPLDFALKMVSLNCIVSVLRSLSSWAHKALNPNTHTANKVLLNTTSSARQESRSSLSN
DVRSSIMTSNDDFKPTYEDEESRSLSSQNIDADDPTQFENLKLRKTALSECIAIFNNKPK
KAIPVLIKKGFLKDDSPISIAKWLLETEGLDMAAVGDYLGEGDDKNIAIMHAFVDEFDFT
GMSIVDALRSFLQSFRLPGEGQKIDRFMLKFAERFVDQNPGVFSKADTAYVLSYSLIMLN
TDLHSSQIKNKMSLQEFLENNEGIDNGRDLPRDFLEGLFNEIANNEIKLISEQHQAMLSG
DTNLVQQQQSAFNFFNSRDLTREAYNQVSKEISSKTELVFKNLNKNKGGPDVYYAASHVE
HVKSIFETLWMSFLAALTPPFKDYDDIDTTNKCLEGLKISIKIASTFRINDARTSFVGAL
VQFCNLQNLEEIKVKNVNAMVILLEVALSEGNYLEGSWKDILLVVSQMERLQLISKGIDR
DTVPDVAQARVANPRVSYESSRSNNTSFFDVWGKKATPTELAQEKHHNQTLSPEISKFIS
SSELVVLMDNIFTKSSELSGNAIVDFIKALTAVSLEEIESSENASTPRMFSLQKMVDVCY
YNMDRIKLEWTPLWAVMGKAFNKIATNSNLAVVFFAIDSLRQLSMRFLDIEELSGFEFQH
DFLKPFEYTVQNSGNTEVQEMIIECFRNFILTKSESIKSGWKPILESLQYTARSSTESIV
LKTQLLVSNDIVTNHFENVFSQEDAFSELVGVFREITKNKRFQKLSLHALESLRKMTQNV
ADICFYNENKTEEERKHNDALLRGKDIFQDVWFPMLFCFNDTIMTAEDLEVRSRALNYMF
DALVAYGGKFNDDFWEKICKKLLFPIFGVLSKHWEVNQFNSHDDLSVWLSTTLIQALRNL
IALFTHYFESLNRMLDGFLGLLVSCICQENDTIARIGRSCLQQLILQNVSKFNEYHWNQI
GDVFDKLFDLTTANELFDYDPLQQGRKSSVSHHQTTNDTSQHSDDDSNDRRENDSNISET
VERAHQEESSEDVGGDMVETLNGQTKLNNGNSVPTVKDELNPKPASLSIPKKTKHMKRNE
SNEDIRRRINIKNSIVVKCVLQLLMIELLNELFENEDFAHCIPYKEAIRITRLLEKSYEF
SRDFNEDYGLRTRLVEARVVDKIPNLLKQETSAAAVLLDIMFQLYLNDDEKKADLITRLI
TICIQVVEGYVSLDDRTMERSINAWRSVIVEILQGYYEFDDEDFRLYCPAMYALVIQILD
KSVPTELRHAIKQFLSRVGELYLSTD
Download sequence
Identical sequences C7GQE9
YDR170C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]