SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL056W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL056W
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.56e-27
Family Dual specificity phosphatase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YNL056W
Sequence length 197
Comment OCA2 ORF Verified Putative protein with similarity to predicted tyrosine phosphatases Oca1p and Siw14p; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YNL056W is not an essential gene
Sequence
MKYIPPLNFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYIGDKDRPLEEYQSFLE
SEKIKYYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLL
QGWSTAGIYQEYGLFSGGMKDGVDLEFITMFETNLKIPRNVIPGFAKHCLYLNELEAAEG
SDDESGSESILTAKQPI
Download sequence
Identical sequences A6ZS22 B3LNR7 B5VQY6 C7GLU5 C8ZGH2 E7LZL0 G2WM47
SCRT_03194 YNL056W YNL056W YNL056W YNL056W YNL056W tr|A6ZS22|A6ZS22_YEAS7 YNL056W YNL056W YNL056W YNL056W YNL056W YNL056W YNL056W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]