SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR151W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR151W
Domain Number 1 Region: 201-299
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000447
Family Thioredoxin-like 2Fe-2S ferredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBR151W
Sequence length 316
Comment APD1 ORF Verified Protein of unknown function, required for normal localization of actin patches and for normal tolerance of sodium ions and hydrogen peroxide; localizes to both cytoplasm and nucleus
Sequence
MAFLNIFKQKRGDEASQLSAKGREEISQSIKICKSDDAANEHSCSGDCKTEIEEGEQAFA
KLKIEHETPLLNSSKTPKIHFVVPTSQIDWQHDACLEDPKSVQYKISQWCDKNSAKFSNV
GTGKTLNCAVSSLPKDIMDIDVMRGTKNNVLILPYFIWLNDLRSDDVEATLDGLVPDLLD
ENISREKLLETRPNVAVARERAFVFICSHTTRDKRCGITAPYLKKVFDSKLQEHGLYRDN
SDYRAEGVKIAFVNHVGGHKFAANVQIYLRNPNTLIWLGRVTPTIVPSIVEHLIVPEEPT
LPFPEKVRCIKKYQSW
Download sequence
Identical sequences A0A0L8VUX5 A0A250WGM6 B3LN08 C7GUV3 D3UEP5 E7K9D5 E7KKF7 E7LRM2 E7Q108 E7QBI8 G2W9F3 H0GCL3 N1P899 P38281
YT270 YBR151W YBR151W YBR151W YBR151W YBR151W YBR151W NP_009709.1.97178 YBR151W YBR151W YBR151W YBR151W YBR151W 4932.YBR151W YBR151W YBR151W YBR151W YBR151W SCRT_02820 YBR151W YBR151W YBR151W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]