SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR244W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR244W
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.33e-62
Family Glutathione peroxidase-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR244W
Sequence length 162
Comment GPX2 ORF Verified Phospholipid hydroperoxide glutathione peroxidase induced by glucose starvation that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress
Sequence
MTTSFXDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVI
LGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLG
FKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK
Download sequence
Identical sequences E7KKL4
YBR244W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]