SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR083W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR083W
Domain Number 1 Region: 16-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.86e-34
Family Thioltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YCR083W
Sequence length 127
Comment TRX3 ORF Verified Mitochondrial thioredoxin, highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p
Sequence
MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKM
MQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTAL
EKGIKDL
Download sequence
Identical sequences A0A250WN97 A6ZTQ5 B3LUD7 C7GUW5 C8Z4H0 E7KA74 G2WA91 H0GD94 N1P7Q3 P25372
YCR083W YCR083W YCR083W YCR083W YCR083W SCRT_05472 YCR083W YCR083W YCR083W YCR083W tr|A6ZTQ5|A6ZTQ5_YEAS7 NP_010006.1.97178 XP_015332299.1.40921 YCR083W YCR083W YCR083W 4932.YCR083W YCR083W YCR083W YCR083W YCR083W YCR083W YCR083W YCR083W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]