SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL091C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL091C
Domain Number 1 Region: 141-257
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000136
Family UAS domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDL091C
Sequence length 261
Comment UBX3 ORF Verified UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p, green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern
Sequence
MDIFRHTFGNNDDSFIRIPGAFREEPPADLNGRTEDQNSNTNEPTQSRDGRLKSILHFLF
QAPLIVLYYLLNFIVRSSRLLKPLLRLHGFYQRKHNRLLDHSSQLHRLLENLENEAQAVT
CSEGNGNNDDGSNTDSTSNNESSGVQFSFGSLYNPENGTFSKSIMQNSYTELLDACSEQV
KFGVIYLHDPLLDNHMDYVNKILCSEAFVNMIRKYQVLLWYGXVTTSEGLQVSNALKIRQ
YPLLGIISLKAEKKNRVNSKS
Download sequence
Identical sequences YDL091C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]