SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL147W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDL147W
Domain Number - Region: 74-109,140-230
Classification Level Classification E-value
Superfamily TPR-like 0.0148
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDL147W
Sequence length 250
Comment RPN5 ORF Verified Essential, non-ATPase regulatory subunit of the 26S proteasome lid, similar to mammalian p55 subunit and to another S. cerevisiae regulatory subunit, Rpn7p
Sequence
MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLLLEKKTRQASDLASSKEVLA
KIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIE
TIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFI
LEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKIXFAQERIPRSCAV
SARNLSNRRH
Download sequence
Identical sequences YDL147W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]