SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR161W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR161W
Domain Number 1 Region: 16-75,163-199,240-274
Classification Level Classification E-value
Superfamily TPR-like 0.00000000759
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR161W
Sequence length 387
Comment ORF Uncharacterized Putative protein of unknown function; non-essential gene; proposed function in rRNA and ribosome biosynthesis based on transcriptional co-regulation; genetic interactions suggest a role in ER-associated protein degradation (ERAD)
Sequence
MSELEATIRQAKEALAENNAKKALKILKPFKSSLKKENANNVILNEVFADAYLDNGQVEK
AYPILARACELDPEGQVGGPDKFFTMGQIMGGQDGVSIITRGIMNISNTGGEMLTNVQVE
KIVGGLLSXIEIWMTDLCMEPNAEEQCEELIQKAMELTEGKSPETWSTLGSIKISQQKFG
EAYEAFSQAWNFFELKKQEIGSGINENGDTTQKAGLQSEYVDLLQPLLSLTKMCLEVGAY
EVALKVIAAVRDIDEDNIEGYYLEGFTYYLMSKLEIFKLNNPEVSLRPENIYEFNQLIQE
VPLDLSHEPISQLIYDSRLALSXALQAGXNADSKDEIVQELLGGANALLQEIGGPLDPSE
LTQIKKGDLVNENEDLEELDIEEEYXD
Download sequence
Identical sequences YDR161W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]