SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR206W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR206W
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily TPR-like 0.00000000872
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR206W
Sequence length 218
Comment EBS1 ORF Verified Protein involved in inhibition of translation and nonsense-mediated decay; interacts with cap binding protein Cdc33p and with Nam7p; localizes to P-bodies upon glucose starvation; mRNA abundance regulated by mRNA decay factors
Sequence
MMTKMXSPVSIKNFGALMVDNKSSLNRSLHTTIMNTYLQESKGPRTPAKEILEFYXLGLF
GSVWSPTSWRDDTKPNQLNNGIKLRHLENALYETMSARYLNNIKTIFHNLIITIGGFHLL
LKRRSDVSAKTLKDLRSNELDYLNFAFKYIAHILNDIVKESWSENPEVSEILGMVRIINC
WIKANPMVLQYSQSNLEFINALAYLINDIVKKKTKSFF
Download sequence
Identical sequences YDR206W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]