SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR244W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR244W
Domain Number 1 Region: 140-451
Classification Level Classification E-value
Superfamily TPR-like 3e-98
Family Tetratricopeptide repeat (TPR) 0.00000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR244W
Sequence length 452
Comment PEX5 ORF Verified Peroxisomal membrane signal receptor for the C-terminal tripeptide signal sequence (PTS1) of peroxisomal matrix proteins, required for peroxisomal matrix protein import; also proposed to have PTS1-receptor independent functions
Sequence
MMNNYAYASMNSLSGSRLQSPAFMNQQQSGRSKEGVNEQEQQPWTDQFEKLEKEVSENLD
INDEIEKEENVSEVEQNKPETVEKEEGVYGDQYQSDFQEVWDSIHKDAEEVLPSELVNDD
LNLGEDYLKYLGGRVNGNIEYAFQSNNEYFNNPNAYKIGCLLMENGAKLSEAALAFEAAV
KEKPDHVDAWLRLGLVQTQNEKELNGISALEECLKLDPKNLEAMKTLAISYINEGYDMSA
FTMLDKWAETKYPEIWSRIKQQDDKFQKEKGFTHIDMNAHITKQFLQLANNLSTIDPEIQ
LCLGLLFYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL
KPSFVRARYNLAVSSMNIGCFKEAAGYLLSVLSMHEVNTNNKKGDVGSLLNTYNDTVIET
LKRVFIAMNRDDLLQEVKPGMDLKRFKGEFSF
Download sequence
Identical sequences YDR244W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]