SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR320C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR320C
Domain Number 1 Region: 53-226
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.46e-29
Family Chaperone J-domain 0.00057
Further Details:      
 
Weak hits

Sequence:  YDR320C
Domain Number - Region: 16-60
Classification Level Classification E-value
Superfamily TPR-like 0.00422
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR320C
Sequence length 232
Comment SWA2 ORF Verified Auxilin-like protein involved in vesicular transport; clathrin-binding protein required for uncoating of clathrin-coated vesicles
Sequence
MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELINK
NFFDDKIMQGKRRCQDFINPPPVKKYMPVKKKTTTTSPATKKQNLTASSSNSPISVDSTS
EIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMP
KRVKVTYMKAVXKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN
Download sequence
Identical sequences YDR320C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]