SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR416W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR416W
Domain Number 1 Region: 21-323
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000712
Family Tetratricopeptide repeat (TPR) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR416W
Sequence length 331
Comment SYF1 ORF Verified Member of the NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs; null mutant has splicing defect and arrests in G2/M; homologs in human and C. elegans
Sequence
MAYIPTNGFFLILSLAKYYISRGRLDSCGDLLKKSLQQTLRYSDFDRIYNFYLLFEQECS
QFILGKLKENDSKFFNQKDWTEKLQAHMATFESLINLYDIYLNDVALRQDSNLVETWMKR
VSLQKSAAEKCNVYSEAILKIDPRKVGTPGSFGRLWCSYGDLYWTSNAISTARELWTQSL
KVPYPYIEDLEEIYLNWADRELDKEGVERAFSILEDALHVPTNPEILLEKYKNGHRKIPA
QTVLFNSLRIWSKYIDYLEAYCPKDANSSDKIFNKTKTAYNTVIDLRLITPAMAENFALF
LQNHXEVMESFQVYEKTIPLFPPRNPIRIMD
Download sequence
Identical sequences YDR416W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]