SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR453C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR453C
Domain Number 1 Region: 5-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.99e-62
Family Glutathione peroxidase-like 0.000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR453C
Sequence length 196
Comment TSA2 ORF Verified Stress inducible cytoplasmic thioredoxin peroxidase; cooperates with Tsa1p in the removal of reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; deletion enhances the mutator phenotype of tsa1 mutants
Sequence
MVAEVQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAK
KFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEG
IALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATI
KPDVKDSKEYFKNANN
Download sequence
Identical sequences A0A0L8VTX2 A6ZZ44 B5VGY3 C7GKP5 C8Z611 E7KBC8 E7KM76 E7LTA1 E7NGA7 E7Q2P8 E7QDK5 H0GEP7 N1P7J0 Q04120
YDR453C YDR453C 4932.YDR453C YDR453C YDR453C tr|A6ZZ44|A6ZZ44_YEAS7 YDR453C YDR453C YDR453C YDR453C NP_010741.1.97178 YDR453C YDR453C YDR453C YDR453C YDR453C YDR453C YDR453C YDR453C YDR453C YDR453C YDR453C YDR453C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]